PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10019345m
Common NameCARUB_v10019345mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 343aa    MW: 38564 Da    PI: 5.3417
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10019345mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.72.1e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +grWT+eEd++l d+++  G g+W++ ++  g++R++k+c++rw +yl
  Carubv10019345m 14 KGRWTAEEDQILSDYIQANGEGSWRSLPKNAGLKRCGKSCRLRWINYL 61
                     79********************************************97 PP

2Myb_DNA-binding52.89.3e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ T+eE++l+v+++  lG++ W+ Ia+ ++ gRt++++k++w+++l
  Carubv10019345m  67 RGNITPEEEDLIVKLHSTLGNR-WSIIANNLP-GRTDNEIKNYWNSHL 112
                      7999******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-21564IPR009057Homeodomain-like
PROSITE profilePS5129416.018961IPR017930Myb domain
SuperFamilySSF466891.14E-2811108IPR009057Homeodomain-like
SMARTSM007174.0E-121363IPR001005SANT/Myb domain
PfamPF002492.1E-141461IPR001005SANT/Myb domain
CDDcd001671.86E-81661No hitNo description
PROSITE profilePS5129425.9462116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.3E-2565116IPR009057Homeodomain-like
SMARTSM007171.9E-1666114IPR001005SANT/Myb domain
PfamPF002494.7E-1567112IPR001005SANT/Myb domain
CDDcd001675.02E-1171112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0051555Biological Processflavonol biosynthetic process
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MGRAPCCEKV GMKKGRWTAE EDQILSDYIQ ANGEGSWRSL PKNAGLKRCG KSCRLRWINY  60
LRSDLKRGNI TPEEEDLIVK LHSTLGNRWS IIANNLPGRT DNEIKNYWNS HLSRKLHSYF  120
RKPTVINVVE NAPKRRPGRT SRSAMKPKRI PNPRNHHKDP ISLKANHQKN KIVLPTTTIE  180
NGEGEKEEDA LMALSSSSFG GAKEPGLGPC GYGDDGCCNP SINGDDGVLC INDDIFDSCF  240
LLNEPDAVHV SSSESNNVEN AEPYGKSYAG NENVEPMADD WDFCWREGQT LWDQKEDLDS  300
VLSWLLTEEE KESEIIRQRD SNDFGQPLDL DQENKMAAWL LS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C7e-241211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00627PBMTransfer from PK06182.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006293058.10.0hypothetical protein CARUB_v10019345mg
SwissprotO222641e-101MYB12_ARATH; Transcription factor MYB12
TrEMBLR0FTY00.0R0FTY0_9BRAS; Uncharacterized protein
STRINGAT3G62610.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G62610.10.0myb domain protein 11